PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa10g010790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 863aa    MW: 98079.2 Da    PI: 9.1137
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa10g010790.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B357.72.1e-1822971194
                    HHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3 11 lksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                    ++++ l++p  f+++h ggk +e+kt +l++ +s ++W vk+  ++++    lt+GWkeFvka++L+ gD+++Fk++g++ f  +v
  Csa10g010790.1 22 SETH-LTIPVVFFSKHiGGK-HEQKTAKLKSdSSEKTWVVKM--DGRR----LTQGWKEFVKAHDLRIGDIIIFKHEGDMVF--RV 97
                    4444.9**********6555.5678****996777*******..9998....***********************9999888..44 PP

2B3681.3e-21159254399
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      + +++++lk++ + lpkk a++  ++ +++  ++l +e+g+sW+++l++r ++g+y++++GWk+F+++n+ kegD + F l+g+ e ++++ ++
  Csa10g010790.1 159 VANVTASNLKTDTINLPKKAASSKALSRRCD-NIILVNEEGNSWTLNLRFRESDGSYYMGGGWKRFCSENRQKEGDLIAFNLVGDGESNPMLCIC 252
                     5678999**************9999997776.*****************************************************9999****99 PP

                     -S CS
              B3  98 rk 99 
                     ++
  Csa10g010790.1 253 QE 254
                     86 PP

3B337.64e-12289370182
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE.....EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy...rkksgryvltkGWkeFvkangLkegDfvvF 82 
                     f++  ++s++ k++ l+lp +f++ +g +++++k+++led++g +  +kli    ++++    l+kGWk F++an++  +  v+F
  Csa10g010790.1 289 FVTLSLTSYNIKNSKLSLPVEFTKING-INNNHKKIILEDKHGVKRLIKLIRdgpNNGR--RGLGKGWKLFCRANDVLKNIPVTF 370
                     6778899****************6555.557889****************998544444..45*************987766655 PP

4B3406.9e-133664361895
                     --HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3  18 lpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     +p +f+ +h  g++k+e  t +l++  s  +We+k+  + ++ r  l  GWkeFv a++L+ gD++vF+++g  +f ++v+
  Csa10g010790.1 366 IPVTFFLKHlqGINKQE--TAKLRTdVSDTVWELKI--EDGR-R--LN-GWKEFVTAHDLRIGDVIVFRHEG--DFVFHVT 436
                     99***99**97666655..5555554999*******..5554.3..56.********************766..5644665 PP

5B347.33.8e-154955731798
                     E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     ++p +fa+++g  k+++ +++l +e grsW++ l ++k++ +++l+ GW++F++ang++ g   +Fkl++ +++ +v+++++
  Csa10g010790.1 495 YVPVSFARSNGWTKACG-KVVLLNEMGRSWNLSLDHDKSGIKTYLRHGWRSFCNANGMNRGGH-TFKLVQ-NSGMPVIRLCQ 573
                     79********9999998.****************999*9999*****************9985.999998.67779999987 PP

6B369.64.1e-226277111398
                     TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     + + +lpk f++++g++ke+  +++l++e gr+W++ l++rk+ +++v+++GW++F++ ngLk++D++ Fkl++ +++++v+ ++ 
  Csa10g010790.1 627 LMLQYLPKGFVSSNGLNKECCDEMVLKNEYGRTWNLVLRHRKSNNTVVMSRGWRSFCQVNGLKARDSFRFKLVR-TGAKPVLCLCP 711
                     55569******************************************************************998.88889999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.3E-238105IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.28E-219109IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.7611103IPR003340B3 DNA binding domain
CDDcd100179.81E-1712100No hitNo description
SMARTSM010195.0E-2414103IPR003340B3 DNA binding domain
PfamPF023624.3E-132395IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.8E-19148251IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-18156244IPR015300DNA-binding pseudobarrel domain
CDDcd100172.77E-17157252No hitNo description
PROSITE profilePS5086314.649157255IPR003340B3 DNA binding domain
SMARTSM010199.4E-23158255IPR003340B3 DNA binding domain
PfamPF023621.9E-19159254IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.4E-12283362IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.65E-12284372IPR015300DNA-binding pseudobarrel domain
CDDcd100172.02E-11288372No hitNo description
SMARTSM010194.3E-15289381IPR003340B3 DNA binding domain
PfamPF023624.9E-11289371IPR003340B3 DNA binding domain
PROSITE profilePS5086310.391289389IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.3E-15366452IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.2E-14366448IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.22383441IPR003340B3 DNA binding domain
PROSITE profilePS508639.404395441IPR003340B3 DNA binding domain
SMARTSM010194.6E-13491575IPR003340B3 DNA binding domain
CDDcd100172.03E-12495572No hitNo description
Gene3DG3DSA:2.40.330.101.6E-13495576IPR015300DNA-binding pseudobarrel domain
PfamPF023621.5E-13495574IPR003340B3 DNA binding domain
SuperFamilySSF1019362.55E-13495579IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.475496575IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.8E-19582711IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.338615713IPR003340B3 DNA binding domain
SMARTSM010196.3E-22624713IPR003340B3 DNA binding domain
PfamPF023627.4E-21625712IPR003340B3 DNA binding domain
SuperFamilySSF1019362.94E-18630716IPR015300DNA-binding pseudobarrel domain
CDDcd100172.30E-18631711No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 863 aa     Download sequence    Send to blast
MLNSPLQSPT NPHFFQPLLP GSETHLTIPV VFFSKHIGGK HEQKTAKLKS DSSEKTWVVK  60
MDGRRLTQGW KEFVKAHDLR IGDIIIFKHE GDMVFRVTPF GPSCCEIQYA QCNIKMEDDN  120
DDEEDDMENQ HSTRNGLRKT KLNPKTEAES FESCDYCFVA NVTASNLKTD TINLPKKAAS  180
SKALSRRCDN IILVNEEGNS WTLNLRFRES DGSYYMGGGW KRFCSENRQK EGDLIAFNLV  240
GDGESNPMLC ICQEEVCSEL MSIAREKIKT KKRRRRWVAS PSSPEQNRFV TLSLTSYNIK  300
NSKLSLPVEF TKINGINNNH KKIILEDKHG VKRLIKLIRD GPNNGRRGLG KGWKLFCRAN  360
DVLKNIPVTF FLKHLQGINK QETAKLRTDV SDTVWELKIE DGRRLNGWKE FVTAHDLRIG  420
DVIVFRHEGD FVFHVTALGL NCCETEYSTS SHSIDDDCDN HQDNIEIRPM KKRVKKNPRR  480
EEDSSSEHSC FVANYVPVSF ARSNGWTKAC GKVVLLNEMG RSWNLSLDHD KSGIKTYLRH  540
GWRSFCNANG MNRGGHTFKL VQNSGMPVIR LCQAGCKPDA ESSSSDCSYF AGSLTPSSFN  600
KDALVSANFY CKDDLTELVD DLWMFNLMLQ YLPKGFVSSN GLNKECCDEM VLKNEYGRTW  660
NLVLRHRKSN NTVVMSRGWR SFCQVNGLKA RDSFRFKLVR TGAKPVLCLC PAETKRDTRV  720
VECSKGTDVD SLSTDPSSGE ESSETEESEV KKNIKDNGRD NSNFKEDSEE ESIEENIKKE  780
KYCSRRGASS SSSQSRFVTL TITPYSYRSN KLRLPLHFTR VNGIEKPGKI TVGSRRSKSD  840
GASCKRPRKR KIETRKRLER IL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1270275KKRRRR
2844850KRPRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010438003.10.0PREDICTED: B3 domain-containing protein REM17-like
RefseqXP_010438004.10.0PREDICTED: B3 domain-containing protein REM17-like
TrEMBLA0A078HRD80.0A0A078HRD8_BRANA; BnaC03g67480D protein
STRINGBra010225.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.11e-101B3 family protein